Protein Info for DZA65_RS06785 in Dickeya dianthicola ME23

Annotation: YbfA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 68 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details PF10725: DUF2517" amino acids 4 to 64 (61 residues), 125 bits, see alignment E=4.2e-41

Best Hits

Swiss-Prot: 66% identical to YBFA_ECOLI: Uncharacterized protein YbfA (ybfA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to ddd:Dda3937_01548)

Predicted SEED Role

"FIG01200701: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYH7 at UniProt or InterPro

Protein Sequence (68 amino acids)

>DZA65_RS06785 YbfA family protein (Dickeya dianthicola ME23)
MMCYVVYPWYRIALRRTAVVLVGVLALPVMLCWRGRARFYSYLHRVWLKTSDKPVWLEQS
EQAAGYFY