Protein Info for DZA65_RS06775 in Dickeya dianthicola ME23

Annotation: potassium-transporting ATPase subunit KdpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 61 to 82 (22 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details amino acids 326 to 346 (21 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details amino acids 378 to 397 (20 residues), see Phobius details amino acids 417 to 436 (20 residues), see Phobius details amino acids 482 to 504 (23 residues), see Phobius details amino acids 525 to 548 (24 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 3 to 556 (554 residues), 819.8 bits, see alignment E=5.9e-251 PF03814: KdpA" amino acids 12 to 555 (544 residues), 806.4 bits, see alignment E=4.9e-247

Best Hits

Swiss-Prot: 76% identical to KDPA_PECAS: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 97% identity to ddd:Dda3937_01549)

MetaCyc: 71% identical to K+ transporting P-type ATPase subunit KdpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CRC9 at UniProt or InterPro

Protein Sequence (561 amino acids)

>DZA65_RS06775 potassium-transporting ATPase subunit KdpA (Dickeya dianthicola ME23)
MPSDAFLLIVSLFALLLMLAQPLSQFMARLVEGETGALRRYELGVARLCGFSTREMGWQH
YAGAILVFNLLGIVLLFLMLAYQDHLPLNPQQMPGLSWHLALNTAISFVTNTNWQAYSGE
SALSYFSQMVGLTVQNFLSAATGIAVAFVLMRAFARRTTHELGNAWLDLLRINLYLLLPI
SLLLSLFFISQGSIQNVLPYHPITTLEGASQVLPMGPLASQEAIKMLGTNGGGFFGANSA
HPFENPNALTNFVQMLSILLIPAALCFTFGRVVNDRRQGHTLLWAMSLMLIVATTVVMYA
EVSGNPHLLSLGADSAQNMEGKESRFGVLSSAFFAAITTATSCGAVNAMHDSFTALGGLI
PMWLMQIGEVIFGGVGSGFYGMLVFVLLTVFIAGLMIGRTPEYLGKKIEAWEMKMAALVI
LITPALVLLGTALALGTEAGRAGILNPGAHGFSEVLYAYSSAANNNGSAFAGLSVNTPFY
NLTLGIAMLLGRFSSLIPVLAIAGSLAAKKRQPETKGSLSTRGPLFIGLLIAIILLISAL
NFIPALALGPVAEHLQSSLVH