Protein Info for DZA65_RS06735 in Dickeya dianthicola ME23

Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF12146: Hydrolase_4" amino acids 16 to 107 (92 residues), 31.4 bits, see alignment E=2.4e-11 PF07819: PGAP1" amino acids 17 to 142 (126 residues), 52.7 bits, see alignment E=1.1e-17 PF00561: Abhydrolase_1" amino acids 18 to 242 (225 residues), 90 bits, see alignment E=3.9e-29 PF12697: Abhydrolase_6" amino acids 19 to 247 (229 residues), 78.7 bits, see alignment E=2e-25

Best Hits

Swiss-Prot: 66% identical to YBFF_ECOLI: Esterase YbfF (ybfF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_01557)

Predicted SEED Role

"Esterase ybfF (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZS9 at UniProt or InterPro

Protein Sequence (256 amino acids)

>DZA65_RS06735 esterase (Dickeya dianthicola ME23)
MKLNYRWQNAQHPQNRLPVILIHGLFGNLDNLGVLARDLQKHHDTLQIDLRNHGLSPRAL
EMNYAAMAQDVRELIDALGLERVILIGHSMGGKASMALTAILAGRIERIVAIDIAPVDYQ
VRRHDKVFAAIRAVSDAGVEQRSTAAEIMRDYLPGEEGVVQFLLKSFQQGEWRFNVPVLW
DQYAHIVGWQDVPAWPGPILFIRGGESPYLDDSYRDALLRQFPAARAHVVSGAGHWVHAE
KPEAVLRAIHRFLAAD