Protein Info for DZA65_RS06715 in Dickeya dianthicola ME23

Annotation: ferric iron uptake transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 PF01475: FUR" amino acids 10 to 130 (121 residues), 164 bits, see alignment E=7.7e-53

Best Hits

Swiss-Prot: 90% identical to FUR_ECOL6: Ferric uptake regulation protein (fur) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03711, Fur family transcriptional regulator, ferric uptake regulator (inferred from 99% identity to ddc:Dd586_1162)

Predicted SEED Role

"Ferric uptake regulation protein FUR" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Iron acquisition in Vibrio or Oxidative stress or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CHQ6 at UniProt or InterPro

Protein Sequence (148 amino acids)

>DZA65_RS06715 ferric iron uptake transcriptional regulator (Dickeya dianthicola ME23)
MTDNNTALKKAGLKVTLPRLKILEVLQDPQCHHVSAEDLYKKLIDMGEEIGLATVYRVLN
QFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGRVIEFSDESIEARQREISEKHGI
KLTNHSLYLYGHCNSGDCREDDNAHNER