Protein Info for DZA65_RS06700 in Dickeya dianthicola ME23

Annotation: glucosamine-6-phosphate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR00502: glucosamine-6-phosphate deaminase" amino acids 1 to 259 (259 residues), 440.9 bits, see alignment E=7.1e-137 PF01182: Glucosamine_iso" amino acids 9 to 230 (222 residues), 76.7 bits, see alignment E=1.3e-25

Best Hits

Swiss-Prot: 86% identical to NAGB_PECCP: Glucosamine-6-phosphate deaminase (nagB) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K02564, glucosamine-6-phosphate deaminase [EC: 3.5.99.6] (inferred from 97% identity to ddd:Dda3937_03951)

MetaCyc: 80% identical to glucosamine-6-phosphate deaminase (Escherichia coli K-12 substr. MG1655)
Glucosamine-6-phosphate deaminase. [EC: 3.5.99.6]

Predicted SEED Role

"Glucosamine-6-phosphate deaminase (EC 3.5.99.6)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.99.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CH60 at UniProt or InterPro

Protein Sequence (266 amino acids)

>DZA65_RS06700 glucosamine-6-phosphate deaminase (Dickeya dianthicola ME23)
MRLIPLTTPAEVGKWAARYIAERIKAFNPTVERPFVLGLPTGSSPLEAYKALIALYHAGQ
VSFKHVVTFNMDEYVGLPAHHPESYRTFMYQNFFNHVDIPEGNINLLNGNAEDIAAECQR
YEEKIKSYGKIHLFMGGVGNDGHIAFNEPASSLVSRTRIKTLTEETRLANSRFFGGDVSQ
VPKYALTVGVGTLLDAEEVMILVSGRHKAQALQAAVEGNVNHMWTISCLQLHARALMVCD
EPSTMELKVKTVKYFRELEAENLKNL