Protein Info for DZA65_RS06535 in Dickeya dianthicola ME23

Annotation: lipoyl(octanoyl) transferase LipB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF21948: LplA-B_cat" amino acids 24 to 199 (176 residues), 113.6 bits, see alignment E=6.4e-37 TIGR00214: lipoyl(octanoyl) transferase" amino acids 25 to 203 (179 residues), 244.2 bits, see alignment E=3.7e-77

Best Hits

Swiss-Prot: 78% identical to LIPB_PECCP: Octanoyltransferase (lipB) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03801, lipoyl(octanoyl) transferase [EC: 2.3.1.181] (inferred from 90% identity to ddc:Dd586_1132)

MetaCyc: 70% identical to lipoyl(octanoyl) transferase (Escherichia coli K-12 substr. MG1655)
Lipoyl(octanoyl) transferase. [EC: 2.3.1.181]; RXN0-1138 [EC: 2.3.1.181]

Predicted SEED Role

"Octanoate-[acyl-carrier-protein]-protein-N-octanoyltransferase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.181

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XUV7 at UniProt or InterPro

Protein Sequence (230 amino acids)

>DZA65_RS06535 lipoyl(octanoyl) transferase LipB (Dickeya dianthicola ME23)
MVRDTIIVRQLGVQPYEPVSQAMHTFTEQRDSHSFDELWLVQHPPVFTQGQAGKAEHVLM
PGDIPVIQSDRGGQVTYHGPGQQVMYVLVDIKRRKVGVRQLVTAIENTVVNTLAHYAVDA
HARPDAPGVYVGERKICSLGLRIRHGCSFHGLALNIVMDLSPFLRINPCGYAGMAMTQLS
ELVPGATLTETAPVMVKAFMQLLDYRQQEWLEWNWLQQGAPHPLSASDAT