Protein Info for DZA65_RS06525 in Dickeya dianthicola ME23

Annotation: twin-arginine translocase subunit TatE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 80 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01411: twin arginine-targeting protein translocase, TatA/E family" amino acids 3 to 47 (45 residues), 64.2 bits, see alignment E=3.2e-22 PF02416: TatA_B_E" amino acids 3 to 45 (43 residues), 39.5 bits, see alignment E=1.6e-14

Best Hits

Swiss-Prot: 88% identical to TATE_DICZ5: Probable Sec-independent protein translocase protein TatE (tatE) from Dickeya zeae (strain Ech586)

KEGG orthology group: K03425, sec-independent protein translocase protein TatE (inferred from 85% identity to ddd:Dda3937_02490)

MetaCyc: 61% identical to twin arginine protein translocation system - TatE protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatE" in subsystem Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DA60 at UniProt or InterPro

Protein Sequence (80 amino acids)

>DZA65_RS06525 twin-arginine translocase subunit TatE (Dickeya dianthicola ME23)
MEGISIAKLLVIGALIVLLFGTNKLRSLGSDLGAAIKGFKKSMSDEQPAAKSSAQDEHPA
AKSSAQDEHPAAISENRPKE