Protein Info for DZA65_RS06510 in Dickeya dianthicola ME23

Annotation: transcription antiterminator/RNA stability regulator CspE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 69 PF00313: CSD" amino acids 5 to 68 (64 residues), 115.8 bits, see alignment E=6.2e-38 PF08206: OB_RNB" amino acids 14 to 37 (24 residues), 24.7 bits, see alignment E=1.5e-09

Best Hits

Swiss-Prot: 94% identical to CSPE_ECOL6: Cold shock-like protein CspE (cspE) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_13805)

Predicted SEED Role

"Cold shock protein CspE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XUT1 at UniProt or InterPro

Protein Sequence (69 amino acids)

>DZA65_RS06510 transcription antiterminator/RNA stability regulator CspE (Dickeya dianthicola ME23)
MSKIKGSVKWFNESKGFGFITPEDGSKDVFVHFSAIQSNGFKTLAEGQRVEFEITSGAKG
PSAANVIAI