Protein Info for DZA65_RS06495 in Dickeya dianthicola ME23

Annotation: M15 family metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF02557: VanY" amino acids 22 to 177 (156 residues), 120.7 bits, see alignment E=1.9e-39

Best Hits

KEGG orthology group: None (inferred from 93% identity to ddd:Dda3937_02500)

Predicted SEED Role

"FIG009095: D,D-carboxypeptidase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CXU8 at UniProt or InterPro

Protein Sequence (222 amino acids)

>DZA65_RS06495 M15 family metallopeptidase (Dickeya dianthicola ME23)
MISSACLTGKSDRHLVTLSGSHRLQPEAVAAFTAMQQAAAQAGFNLQPASTFRDFERQRQ
IWNDKFAGQRPLLDQHSQPLDALALDEGARCEAILRWSALPGGSRHHWGSDLDIYDPDRL
PAGQKLQLEPWEYQPGGYFAELSDWLTQHMAAFGFYRPFAQDSGGIAIEPWHLSYAPLAR
LAMAQLTPKHILRAWQGEDIAGRGWLEPNLTMLFQRFILCDV