Protein Info for DZA65_RS06430 in Dickeya dianthicola ME23

Annotation: uracil permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 60 (17 residues), see Phobius details amino acids 67 to 83 (17 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 115 to 141 (27 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 183 to 183 (1 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 225 to 250 (26 residues), see Phobius details amino acids 301 to 326 (26 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 366 to 386 (21 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 11 to 404 (394 residues), 418.8 bits, see alignment E=1.2e-129 PF00860: Xan_ur_permease" amino acids 16 to 382 (367 residues), 360.7 bits, see alignment E=4e-112

Best Hits

Swiss-Prot: 84% identical to URAA_ECO57: Uracil permease (uraA) from Escherichia coli O157:H7

KEGG orthology group: K02824, uracil permease (inferred from 94% identity to ddc:Dd586_1110)

MetaCyc: 84% identical to uracil:H+ symporter UraA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-132

Predicted SEED Role

"Uracil permease" in subsystem De Novo Pyrimidine Synthesis or Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CYE5 at UniProt or InterPro

Protein Sequence (432 amino acids)

>DZA65_RS06430 uracil permease (Dickeya dianthicola ME23)
MTRRAIGVSERPPLLQTIPLSFQHLFAMFGATVLVPILFKINPATVLLFNGIGTLLYLFI
CKGKIPAYLGSSFAFLSPVLLLLPQGYEVALGGFILCGALFCLVALLVKKVGIGWLNVIF
PPAAMGAIVAVIGLELAGVAANMAGLLPAAGTDVDGKTVTISLVTLAVTILGSVLFRGFL
AIIPILIGVLAGYVLSFVMGVVDLAPIAQAHWFALPTFYTPRFEWVAMLTVLPAALVVIA
EHIGHLVVTANIVKKDLVRDPGLHRSLFANGVSTMLSGFFGSTPNTTYGENIGVLAITKV
YSTWVIGGAAVLAILLSCVGKLAAAIQAVPVPVMGGVSLLLYGVIGASGIRVLIESKVDY
NKAQNLILTSVILIIGVSGAKIHLGAVELKGMALATVVGVFLSLLFHVISVFRKEEEVEE
VIDEADDKTSAS