Protein Info for DZA65_RS06345 in Dickeya dianthicola ME23

Annotation: co-chaperone YbbN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF00085: Thioredoxin" amino acids 8 to 109 (102 residues), 75.7 bits, see alignment E=6.3e-25 PF13728: TraF" amino acids 10 to 89 (80 residues), 28.5 bits, see alignment E=3.4e-10 PF13098: Thioredoxin_2" amino acids 26 to 111 (86 residues), 30.5 bits, see alignment E=1e-10 PF14559: TPR_19" amino acids 126 to 192 (67 residues), 66 bits, see alignment E=8e-22 PF14561: TPR_20" amino acids 197 to 286 (90 residues), 104.5 bits, see alignment E=7.8e-34

Best Hits

Swiss-Prot: 72% identical to CNOX_ECOLI: Chaperedoxin (cnoX) from Escherichia coli (strain K12)

KEGG orthology group: K05838, putative thioredoxin (inferred from 96% identity to ddd:Dda3937_01788)

Predicted SEED Role

"FIG000875: Thioredoxin domain-containing protein EC-YbbN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CML5 at UniProt or InterPro

Protein Sequence (286 amino acids)

>DZA65_RS06345 co-chaperone YbbN (Dickeya dianthicola ME23)
MLEQHANVIDINETNLHQVLEQSMSAPVLFYFWSERSPHCQQLEPVLNKLAAEYAGQFIL
AKVDCDAEQRVAAQFGLRAIPTVYLFKDGQPVDGFQGPQPEEVIRDLLQRVLPKAEDLKL
AQAQQLIQENQLKEAAVLLKDAWQLDAKRSDIALLLADVQIQLNRTDDAQTVLDTIPLQD
QDTRYHGLVAQIELMKQAADTPEIQQLQQQLATSPDNEELAVQLSLQLHQVGRNEEALEL
LMGMLKKDLTAAGGNARKTLMDIMAALGTGDALAAHYRRQLYSLLY