Protein Info for DZA65_RS06295 in Dickeya dianthicola ME23

Annotation: 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylic-acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00173: 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
  • amino acids 10 to 432 (423 residues), 450.5 bits, E=4e-139
• PF02776: TPP_enzyme_N
  • amino acids 10 to 118 (109 residues), 65.7 bits, E=5e-22
• PF16582: TPP_enzyme_M_2
  • amino acids 184 to 390 (207 residues), 246.4 bits, E=3.8e-77
• PF02775: TPP_enzyme_C
  • amino acids 425 to 537 (113 residues), 32 bits, E=1.6e-11

Best Hits

Swiss-Prot: 72% identical to MEND_PECAS: 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase (menD) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02551, 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [EC: 2.2.1.9] (inferred from 95% identity to ddd:Dda3937_01781)

MetaCyc: 66% identical to 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase (Escherichia coli K-12 substr. MG1655)
synthase. [EC: 2.2.1.9]

Predicted SEED Role

"2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 2.2.1.9)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (8/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.9

Sequence Analysis Tools

See A0A385XZK2 at UniProt or InterPro

Protein Sequence (558 amino acids)

>DZA65_RS06295 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylic-acid synthase (Dickeya dianthicola ME23)
MSTHIFNRRWATVIVEALSHQGVRHICIAPGSRSTPLTLAAASHPTLVCHTHFDERGLGH
LALGLAKASGEAVAVIVTSGTAAANLYPAIIEAGLTGERLVILTADRPPELIDCGANQAI
RQPGMFASHPTSTLNLPRPTCDIPARWLVSALDNALSELCHGALHINCPFAEPLYGEDDP
AAFQDWLQALGDWWHQPQPWLQDARATPLATMQPDWPQWRQRRGVVIAGRVPAPAGERIA
AWARQLGWPLIGDVLSQTGQPLACADLWLQHPQAETLRQAEIVVQFGASLTGKRLLQWQA
ASAPDQYWLVDSLPGRLDPAQHRGSRLVADIVDWLAAHPAVVQPAWAPEVEACAERVFRQ
AAARLSGDFGEAQLAHRVAELLLPEGQFFVGNSLTIRLVDAFARLPAGYPVYANRGASGI
DGLLSTLAGVQRANARPMLAIVGDLSALYDLNGLALLRQPPAPLVLVVVNNDGGQIFSLL
PTPEAQREAFYCMPQQVDFRHAAALFGLRYARAQQWSEVQDAVNAGWRQGGTTLLEVVVA
PKAGAETLQRLSAEVASW