Protein Info for DZA65_RS06230 in Dickeya dianthicola ME23

Annotation: Cu(I)-responsive transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 TIGR02044: Cu(I)-responsive transcriptional regulator" amino acids 1 to 126 (126 residues), 191.2 bits, see alignment E=3.2e-61 PF13411: MerR_1" amino acids 1 to 67 (67 residues), 66.1 bits, see alignment E=3.7e-22 PF00376: MerR" amino acids 2 to 39 (38 residues), 50.5 bits, see alignment E=2.2e-17 PF09278: MerR-DNA-bind" amino acids 45 to 108 (64 residues), 64.5 bits, see alignment E=1.7e-21

Best Hits

Swiss-Prot: 75% identical to CUER_SALTY: HTH-type transcriptional regulator CueR (cueR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11923, MerR family transcriptional regulator, copper efflux regulator (inferred from 98% identity to ddd:Dda3937_04160)

Predicted SEED Role

"HTH-type transcriptional regulator cueR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CQK5 at UniProt or InterPro

Protein Sequence (140 amino acids)

>DZA65_RS06230 Cu(I)-responsive transcriptional regulator (Dickeya dianthicola ME23)
MNISDVAKKTGLTSKTIRFYEEKGLMTAPLRCENGYRSYDLHHIEELTLLRQARQVGFTL
EECRELVTLFNDPLRHSADVKARTLQKVDDIEQQIEELKAMRQRLLALAESCPGDNSAEC
PIITQLAGCCHASSEAHGKH