Protein Info for DZA65_RS06155 in Dickeya dianthicola ME23

Annotation: DNA polymerase III subunit gamma/tau

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 TIGR02397: DNA polymerase III, subunit gamma and tau" amino acids 3 to 356 (354 residues), 441.8 bits, see alignment E=1e-136 PF13177: DNA_pol3_delta2" amino acids 20 to 178 (159 residues), 149.4 bits, see alignment E=4.3e-47 PF13401: AAA_22" amino acids 42 to 154 (113 residues), 27.5 bits, see alignment E=1.5e-09 PF00004: AAA" amino acids 42 to 170 (129 residues), 42.4 bits, see alignment E=4.3e-14 PF07728: AAA_5" amino acids 42 to 145 (104 residues), 24.9 bits, see alignment E=8.3e-09 PF22608: DNAX_ATPase_lid" amino acids 182 to 230 (49 residues), 83.5 bits, see alignment 3.1e-27 PF12169: DNA_pol3_gamma3" amino acids 232 to 361 (130 residues), 90 bits, see alignment E=5.8e-29 PF12168: DNA_pol3_tau_4" amino acids 442 to 524 (83 residues), 95.2 bits, see alignment E=1.2e-30 PF12170: DNA_pol3_tau_5" amino acids 526 to 667 (142 residues), 191.1 bits, see alignment E=4.9e-60

Best Hits

KEGG orthology group: K02343, DNA polymerase III subunit gamma/tau [EC: 2.7.7.7] (inferred from 94% identity to ddd:Dda3937_03291)

Predicted SEED Role

"DNA polymerase III subunits gamma and tau (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CLZ3 at UniProt or InterPro

Protein Sequence (670 amino acids)

>DZA65_RS06155 DNA polymerase III subunit gamma/tau (Dickeya dianthicola ME23)
MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTTIARLLAK
GLNCETGITATPCGQCDTCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRF
KVYLIDEVHMLSRHSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFHLKALDA
EQIRRHLQQVLEQEQLAAEPRALQLLARAADGSLRDALSLTDQAIAMGQGQVTAAAVSQM
LGTLDDEQPLALIEALVKGDGAGVMALMGQAAARGVDWEALLVETLTLLHRIAMLQLLPS
ALGDEYNQVAPRLRELARVIPPAEVQLYYQTLLVGRKELPYAPERRMGVEMTLLRALAFH
PSQTIAEPVPVSAPSAVPAAGAPLPADPSRVPPSVRPSAMPVVSGDEALSRHVPATGSEP
PAAPAPDSNLPDATAQLLQARSQLLNRQGNTPTKKAEPAASGKARPVNSALERLASVTER
GQQQMAAKAVAQEEQKKQEAYRWRAQKKAEQVETAPVTTPKALRSALEYEKTPELAAQLA
EEAIERDAWAAEIDRLTLPKLVQQLALNAFKEMPEEGVIHLHLRTSQRHLNSAAAQKMLS
EALAAHYGRPISLTVTEDDTPAVRTPLEWRQAIYEEKLAQARQSIMADNNIQTLRRFFDA
ELDEESIRPV