Protein Info for DZA65_RS06060 in Dickeya dianthicola ME23

Annotation: SmdB family multidrug efflux ABC transporter permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 40 to 41 (2 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 275 to 292 (18 residues), see Phobius details PF00664: ABC_membrane" amino acids 27 to 295 (269 residues), 138.6 bits, see alignment E=3.5e-44 PF00005: ABC_tran" amino acids 357 to 505 (149 residues), 102.6 bits, see alignment E=2.7e-33

Best Hits

Swiss-Prot: 74% identical to MDLB_ECOLI: Multidrug resistance-like ATP-binding protein MdlB (mdlB) from Escherichia coli (strain K12)

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 97% identity to ddd:Dda3937_03310)

Predicted SEED Role

"Multidrug resistance-like ATP-binding protein mdlB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XUM3 at UniProt or InterPro

Protein Sequence (597 amino acids)

>DZA65_RS06060 SmdB family multidrug efflux ABC transporter permease/ATP-binding protein (Dickeya dianthicola ME23)
MNNSRALWPTLKRLLAYGLPWKKTVGAGVLLLWVAAGAEMAGPVLVSYFIDHLVSKGEFP
LMVAAGLAAGYVVLQGIAALLHYVQALMFNRVAVGVVQQLRIDVMDAALRQPLAVFDTQP
VGQLISRVTNDTEVVRDLYVMVVGSVLRSAALIGAMLIAMFTLDWRMALVTLTIFPAVAI
VMVIYQRYSTPIVRRMRSYLADINDGFNESISGMSVIQQFRQQVRFGKKLSEASRAHYET
RMQTLRLDGFLLRPLLSLFSALVMCGLLLQFGFSSVGSVGVGILYAFINYLGRLNEPLIE
LTTQQSMLQQAVVAGERIFELMDGARQRYGDDVRALESGRIDIGQVTFSYHKGKPVLHDI
ELHVPDRGFVALVGHTGSGKSTLASLLMGYYVPDRGEIRLDDRPLSSLSHQVLRQHVAMV
QQDPVVLADSMYANVTLGRDISEENVWQVLDAVQLAPLVRAMPEGLHTRVGEQGNNLSVG
QKQLLALARVLVAAPRILILDEATANIDSGTEQAIQRALRLVRSHTTLVVIAHRLSTIVE
ADNILVLHHGKTVEQGTHEQLLTREGRYYQMYQLQQASRELVFSQPHDSSKLISQAP