Protein Info for DZA65_RS05845 in Dickeya dianthicola ME23

Annotation: DUF479 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF04336: ACP_PD" amino acids 1 to 184 (184 residues), 200.8 bits, see alignment E=1e-63

Best Hits

Swiss-Prot: 77% identical to ACPH_PECAS: Acyl carrier protein phosphodiesterase (acpH) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K08682, acyl carrier protein phosphodiesterase [EC: 3.1.4.14] (inferred from 94% identity to ddd:Dda3937_01946)

MetaCyc: 62% identical to acyl carrier protein phosphodiesterase (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] phosphodiesterase. [EC: 3.1.4.14]

Predicted SEED Role

"Acyl carrier protein phosphodiesterase (EC 3.1.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 3.1.4.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVB3 at UniProt or InterPro

Protein Sequence (201 amino acids)

>DZA65_RS05845 DUF479 domain-containing protein (Dickeya dianthicola ME23)
MNFLAHLHLATLAQSSLTGNLMADFVRGNPDSLYSPEIVAGIRLHRRIDVLTDSLPEVRT
ACRHFSADYRRVAPISLDVLWDHFLARHWAELEPAMPLTHFVADAEQQITPHLADSPERF
RNLNYYLWPERWLERYAELPFIADVLHRMSVRRPKLAALSGSFVDIERHYHQFETLFWQF
YPRMMHLAKTGQLDGPADAAQ