Protein Info for DZA65_RS05835 in Dickeya dianthicola ME23

Annotation: proline-specific permease ProY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 86 to 114 (29 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 196 to 219 (24 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 332 to 350 (19 residues), see Phobius details amino acids 356 to 382 (27 residues), see Phobius details amino acids 394 to 421 (28 residues), see Phobius details amino acids 427 to 445 (19 residues), see Phobius details PF03845: Spore_permease" amino acids 11 to 280 (270 residues), 24.7 bits, see alignment E=1.6e-09 PF13520: AA_permease_2" amino acids 15 to 439 (425 residues), 123.8 bits, see alignment E=1.4e-39 PF00324: AA_permease" amino acids 15 to 449 (435 residues), 382.9 bits, see alignment E=3.4e-118

Best Hits

Swiss-Prot: 83% identical to PROY_SALTY: Proline-specific permease ProY (proY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 98% identity to ddd:Dda3937_01944)

MetaCyc: 48% identical to threonine/serine:H+ symporter ThrP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71; TRANS-RXN-72

Predicted SEED Role

"Proline-specific permease proY" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XUH3 at UniProt or InterPro

Protein Sequence (450 amino acids)

>DZA65_RS05835 proline-specific permease ProY (Dickeya dianthicola ME23)
MEQQSTLKRGLSTRHIRFIALGSAIGTGLFYGSASAIQMAGPSVLLAYLIGGVFAYIIMR
ALGEMSVNNPQASSFSRYARDYLGPLAGYITGWTYCFEMLIVAIADVTAFGIYMGVWFPA
VPHWVWVLSVVLIIGAINLMNVKVFGELEFWLSFFKVATIVVMIVAGVGIIVWGIGNGGE
PTGIHNLWTNGGFFSNGVMGMILSLQMVMFAYGGVEIIGITAGEAKEPHKSIPRAINSVP
WRILVFYVGTLFVIMSIYPWNQVGTNGSPFVLTFQHMGITAAAGILNFVVITASLSAINS
DVFGVGRMLHGMAEQGHAPQVFGRLSQRGTPWVTVVVMMLALLVAVYLNYIMPEKVFLVI
ASLATFATVWVWIMILCSQIAFRRKLSREQANALAFPLPGGAATAVVGIVFLVFIIGLIG
YFPDTRIALYAGMVWMALLLASYALRRRRA