Protein Info for DZA65_RS05820 in Dickeya dianthicola ME23

Annotation: phosphate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02136: phosphate binding protein" amino acids 18 to 297 (280 residues), 223.8 bits, see alignment E=1.4e-70 PF12849: PBP_like_2" amino acids 21 to 278 (258 residues), 104.6 bits, see alignment E=7.8e-34 PF13531: SBP_bac_11" amino acids 34 to 294 (261 residues), 31.8 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 57% identical to PSTS_PSEAB: Phosphate-binding protein PstS (pstS) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 96% identity to ddd:Dda3937_01941)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CD12 at UniProt or InterPro

Protein Sequence (326 amino acids)

>DZA65_RS05820 phosphate ABC transporter substrate-binding protein (Dickeya dianthicola ME23)
MMPTRRLLALLLCLFGQAAAAAPQAMLAGNLSSAGSDTLANLMTFWAADFSQHYPGVNLQ
IQAAGSSSAPTALAAGAAQLGPMSRPMKSSEIDVFEQHYGYAPTAVPVALDALVVLVNQD
NPITGLTVRQLDAIFSVTRRCGAGKTVQRWQELGLNGVWRQRSLLRYGRNSASGTYGFFK
QHALCGGDFLPQVNELPGSASVVQAVAASVNAIGYASIGFRASGVRVLPLAAGDKDDYVL
PTADTIRSGRYPYTRYLYIYVNKMPGKPLEPLTAAFLGRVLSAPGQALVSQDGYLPLPEM
AREQARQLLGLDDAAPASDSDPAKNR