Protein Info for DZA65_RS05690 in Dickeya dianthicola ME23

Annotation: alkylphosphonate utilization protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 TIGR00686: putative alkylphosphonate utilization operon protein PhnA" amino acids 3 to 113 (111 residues), 161.3 bits, see alignment E=3.8e-52 PF08274: Zn_Ribbon_YjdM" amino acids 3 to 32 (30 residues), 48.4 bits, see alignment E=7.8e-17 PF03831: YjdM" amino acids 46 to 113 (68 residues), 116 bits, see alignment E=5.4e-38

Best Hits

Swiss-Prot: 71% identical to YJDM_ECOLI: Protein YjdM (yjdM) from Escherichia coli (strain K12)

KEGG orthology group: K06193, phosphonoacetate hydrolase [EC: 3.11.1.2] (inferred from 95% identity to dze:Dd1591_3129)

Predicted SEED Role

"Alkylphosphonate utilization operon protein PhnA" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CH22 at UniProt or InterPro

Protein Sequence (113 amino acids)

>DZA65_RS05690 alkylphosphonate utilization protein (Dickeya dianthicola ME23)
MQQLPACPKCHSEYTWQDDAMFNCPECGHVWSTQGDGGAQEEGLVVRDANGNLLADGDTV
TVVKDLKVKGSSSTLKIGTRVKGIRLVEGDHNIDCKIDGFGAMKLKSEFVKKN