Protein Info for DZA65_RS05685 in Dickeya dianthicola ME23

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 44 to 69 (26 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 160 to 187 (28 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 283 to 314 (32 residues), see Phobius details amino acids 364 to 388 (25 residues), see Phobius details PF05977: MFS_3" amino acids 3 to 388 (386 residues), 140.1 bits, see alignment E=8.7e-45 PF07690: MFS_1" amino acids 16 to 350 (335 residues), 99.1 bits, see alignment E=2.6e-32

Best Hits

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_01913)

Predicted SEED Role

"MFS general substrate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CIY8 at UniProt or InterPro

Protein Sequence (406 amino acids)

>DZA65_RS05685 MFS transporter (Dickeya dianthicola ME23)
METVSPLKNPTFLCFWIGQIASSFAFQMLVVGIGWQMYDLTNSALNLGLVGLAQFLPQLA
LTLVAGHVVDQYNRRVIILCCRLLMAATILVLVLGNVTHTISAAMIYACSALLGATRAFE
MPATQALLPNLIAPGLLSRAVALMASAREATVIVGPALGGLIYLIGATTLYAASVACFLM
SFLVLLNLRYEYKALARTPVNLESLFGGMNFIRRNPVILGSISLDMFAVLLGGATALLPI
VAKDILHTGPWGLGLLRCAPALGAVLMSVYLSRRPLTRHVGKIMFSAVAMFGAATIAFGL
STNLFLSLFALLFLGASDMVSVVIRSTLVQLETPDDMRGRVSAANSIFIGTSNQLGEFES
GVTAAWLGVVPAIVLGGVGTLLVVALWMKYFPTLAQRQTLEAGERT