Protein Info for DZA65_RS05620 in Dickeya dianthicola ME23

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF13302: Acetyltransf_3" amino acids 53 to 158 (106 residues), 59.2 bits, see alignment E=1.2e-19 PF00583: Acetyltransf_1" amino acids 66 to 157 (92 residues), 35.9 bits, see alignment E=1.3e-12 PF13420: Acetyltransf_4" amino acids 75 to 177 (103 residues), 40.2 bits, see alignment E=5.4e-14

Best Hits

KEGG orthology group: K03790, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 88% identity to ddc:Dd586_0958)

Predicted SEED Role

"Ribosomal-protein-S5p-alanine acetyltransferase" in subsystem Ribosomal protein S5p acylation or Ribosome biogenesis bacterial

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.128

Use Curated BLAST to search for 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XUI1 at UniProt or InterPro

Protein Sequence (186 amino acids)

>DZA65_RS05620 GNAT family N-acetyltransferase (Dickeya dianthicola ME23)
MSIEKTKLFSTARTDVYSLTEDFSEQLQLFLVENRDNFAPFEPLRTEDYFSLDSIRQRIV
DSQPDFKAKKCLLLVFTSKGENKIIGSINFTNFVYGVFQAGYLGFSIDKSFQGQGLMRET
LESAIAYVHENYGLHRIMANHLPENIRSQKILASLGFVREGFAKSYLKINGTWQDHVLNS
YITPEK