Protein Info for DZA65_RS05595 in Dickeya dianthicola ME23

Annotation: 3-oxoacyl-ACP reductase FabG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00106: adh_short" amino acids 7 to 195 (189 residues), 182.3 bits, see alignment E=1.9e-57 PF23441: SDR" amino acids 9 to 243 (235 residues), 46.3 bits, see alignment E=9.4e-16 PF01370: Epimerase" amino acids 9 to 187 (179 residues), 24.4 bits, see alignment E=4.5e-09 PF08659: KR" amino acids 10 to 181 (172 residues), 35 bits, see alignment E=3.5e-12 PF13561: adh_short_C2" amino acids 13 to 245 (233 residues), 202.4 bits, see alignment E=2.1e-63

Best Hits

KEGG orthology group: None (inferred from 96% identity to dze:Dd1591_3138)

MetaCyc: 36% identical to 4-sulfobenzyl alcohol dehydrogenase subunit (Comamonas testosteroni T-2)
1.1.1.M5 [EC: 1.1.1.M5]; 4-(hydroxymethyl)benzenesulfonate dehydrogenase. [EC: 1.1.1.M5, 1.1.1.257]

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [NADPH] (EC 1.3.1.10)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.257 or 1.1.1.M5 or 1.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XUH6 at UniProt or InterPro

Protein Sequence (246 amino acids)

>DZA65_RS05595 3-oxoacyl-ACP reductase FabG (Dickeya dianthicola ME23)
MTELIGKKALVTGASRGIGAAIALELAEKGADVAITYQNSDARALEVVQAIEAKGRRAFA
IKANSADAQAVTHSVHEAADKLGGLDILVNNAGIARAGMVADMSLAYINDILDVNVRAVV
LASQAAITHLSEGGRIISIGSGVAERVPYPGMAVYAMSKSALLSFTRGLARELGPRGITV
NLVHPGSTDTDMNPADGSHADAQRVLIALGEYGKPEDIAAAVAFLASPAARHITGTGITV
DGGANA