Protein Info for DZA65_RS05570 in Dickeya dianthicola ME23

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 852 TIGR01070: DNA mismatch repair protein MutS" amino acids 10 to 849 (840 residues), 1314.3 bits, see alignment E=0 PF01624: MutS_I" amino acids 11 to 122 (112 residues), 147.5 bits, see alignment E=5.3e-47 PF05188: MutS_II" amino acids 131 to 256 (126 residues), 125.5 bits, see alignment E=6e-40 PF05192: MutS_III" amino acids 272 to 559 (288 residues), 175.7 bits, see alignment E=4.4e-55 PF05190: MutS_IV" amino acids 428 to 517 (90 residues), 103.6 bits, see alignment E=1.7e-33 PF00488: MutS_V" amino acids 610 to 797 (188 residues), 300 bits, see alignment E=2.5e-93 PF27441: MutS_C" amino acids 820 to 851 (32 residues), 56.3 bits, see alignment (E = 6.1e-19)

Best Hits

Swiss-Prot: 85% identical to MUTS_CROS8: DNA mismatch repair protein MutS (mutS) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 98% identity to ddd:Dda3937_01899)

MetaCyc: 84% identical to DNA mismatch repair protein MutS (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XUH4 at UniProt or InterPro

Protein Sequence (852 amino acids)

>DZA65_RS05570 DNA mismatch repair protein MutS (Dickeya dianthicola ME23)
MSTPESLDAHTPMMQQYLKLKAQHPDILLFYRMGDFYELFYDDAKRASQLLDISLTKRGA
SAGEPIPMAGVPHHAVENYLAKLVQLGESVAICEQIGDPATSKGPVERKVVRIVTPGTIS
DEALLQEKQDNLLAAVWQEGRGFGYATLDISSGRFRLVEPVDRETMTAELQRTNPAELLY
PETFEAMSLIEHRHGLRRRPLWEFELDTARQQLNLQFGTRDLTGFGVEQAHLGLRAAGCL
LQYAKDTQRTSLPHIRGITVERQQDGIIMDAATRRNLELTQNLSGSGENTLASVLDRTVT
PMGSRMLKRWLHAPIRDVQSLLRRQQAIGALRDVAAELQPFLRQVGDLERILARLALRSA
RPRDLARMRHAFQQLPDIHALLETVNAEAVQQLREHVGHFDELRDLLERAVVEAPPVLVR
DGGVIAGGYNDELDEWRMLADGASDYLEKLEIRERDRLGIDTLKVGFNGVHGYYIQVSRG
QSHLVPMNYVRRQTLKNAERYIIPELKEYEDKVLTSKGKALALEKALYEELFDLLLPHLA
ELQQSAGALAELDVLANLAERADTLNYICPTLSDKPGIRITGGRHPVVEQVLSEPFIANP
LSLSPQRRLLIITGPNMGGKSTYMRQAALIVLMAHIGSYVPAEQAMVGPVDRIFTRVGAA
DDLASGRSTFMVEMTETANILHNATEHSLVLMDEIGRGTSTYDGLSLAWACAEALANKIK
AMTLFATHYFELTNLPEKMEGVINIHLDALEHGDTIAFMHSVQEGAASKSYGLAVAALAG
VPKDVIKRARQKLKELESLAGHASASHVDGSQLALLTPEEPSPALEALEAIDPDALTPRQ
ALDWLYKLKGMM