Protein Info for DZA65_RS05545 in Dickeya dianthicola ME23

Annotation: tRNA lysidine(34) synthetase TilS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 PF00733: Asn_synthase" amino acids 11 to 75 (65 residues), 21.3 bits, see alignment E=4e-08 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 24 to 205 (182 residues), 168.3 bits, see alignment E=1.8e-53 PF01171: ATP_bind_3" amino acids 25 to 201 (177 residues), 186.7 bits, see alignment E=7e-59 PF09179: TilS" amino acids 250 to 317 (68 residues), 78 bits, see alignment E=1.1e-25 PF11734: TilS_C" amino acids 366 to 435 (70 residues), 81.3 bits, see alignment E=5.5e-27 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 367 to 411 (45 residues), 45.9 bits, see alignment 2.9e-16

Best Hits

Swiss-Prot: 66% identical to TILS_PECAS: tRNA(Ile)-lysidine synthase (tilS) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 91% identity to ddd:Dda3937_01894)

MetaCyc: 53% identical to tRNAIle-lysidine synthetase (Escherichia coli K-12 substr. MG1655)
RXN-1961 [EC: 6.3.4.19]

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XUG6 at UniProt or InterPro

Protein Sequence (442 amino acids)

>DZA65_RS05545 tRNA lysidine(34) synthetase TilS (Dickeya dianthicola ME23)
MNADSDIFPELLAAVDAQIAADGRYLVAYSGGLDSCVLLHLMTRLRSRRALSLRAVYVHH
GLSKYADAWAEHCRAQCLRWQVPFDVLPVEVDARDGGVEAAARAARYQALQQHLRDGETL
LTAQHQDDQSETFLLALKRGSGPAGLASMAATARPNGVRLQRPLLGITREQLDAYAGAYP
LTWVEDDSNADERYDRNFLRRQVLPVLKRRWPHFPSAVARSAELCAEQEQLLDELLAESL
ARVRNADGALSVAALTPMSAARRFALLRRWLAEQGVRMPSRGQLTRLWEEVATSREDANP
CLQLGSWQVRRFRHYLYLLPPMTPLTGYVLPWQPAAAPLPLPDNLGQLRVSTQGTWMRQP
RHDEAVTVRFGFQGYVQIVGRAHGRPIKKLWQELDVPPWLREHTPLIFYNDRLIAAVGRF
VTREGQAASDEDGWFIDRCGLK