Protein Info for DZA65_RS05505 in Dickeya dianthicola ME23

Annotation: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 TIGR01853: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD" amino acids 9 to 329 (321 residues), 416.7 bits, see alignment E=2.8e-129 PF04613: LpxD" amino acids 22 to 89 (68 residues), 82.4 bits, see alignment E=3.4e-27 PF00132: Hexapep" amino acids 109 to 144 (36 residues), 34.2 bits, see alignment 2.9e-12 amino acids 145 to 179 (35 residues), 35.6 bits, see alignment 1e-12 amino acids 222 to 255 (34 residues), 29.2 bits, see alignment 1.1e-10 PF14602: Hexapep_2" amino acids 111 to 143 (33 residues), 25.6 bits, see alignment 1.6e-09 amino acids 147 to 178 (32 residues), 11.8 bits, see alignment 3.3e-05

Best Hits

Swiss-Prot: 88% identical to LPXD_PECAS: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase (lpxD) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 99% identity to ddd:Dda3937_01886)

MetaCyc: 82% identical to UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase (Escherichia coli K-12 substr. MG1655)
UDPHYDROXYMYRGLUCOSAMNACETYLTRANS-RXN [EC: 2.3.1.191]

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (EC 2.3.1.191)" (EC 2.3.1.191)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.191

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CVD1 at UniProt or InterPro

Protein Sequence (340 amino acids)

>DZA65_RS05505 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase (Dickeya dianthicola ME23)
MFSIRLDALAQQLDAQLHGDGDIVITAVASMHSAQAGQITFLSDSRYREQLNSTQASAVV
LTEADLPFCDMAALVVKNPYLAYARMAQLMDTTPAPAQGIAPSAVIAPDARLGDGVSVGA
NAVIESGVELGNGAIVGAGCFIGKNARIGAGTRLWANVTIYHNVVLGEQCLIQSGAVIGS
DGFGYANDRGNWIKIPQLGTVIIGDRVEIGASTTIDRGALDDTIIGNGVIIDNQCQIAHN
VVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGV
YSSGIPLQPNKVWRKTAALVMNIDEMSKRLKAVERKLEDR