Protein Info for DZA65_RS05320 in Dickeya dianthicola ME23

Annotation: prepilin peptidase-dependent protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 12 to 19 (8 residues), see Phobius details amino acids 38 to 41 (4 residues), see Phobius details transmembrane" amino acids 20 to 37 (18 residues), see Phobius details TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 11 to 32 (22 residues), 18.1 bits, see alignment (E = 8.8e-08) PF27121: PpdB" amino acids 48 to 191 (144 residues), 116.3 bits, see alignment E=6.6e-38

Best Hits

KEGG orthology group: K02680, prepilin peptidase dependent protein B (inferred from 88% identity to ddd:Dda3937_00853)

Predicted SEED Role

"FIG004819: Prepilin peptidase dependent protein B precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XUY0 at UniProt or InterPro

Protein Sequence (197 amino acids)

>DZA65_RS05320 prepilin peptidase-dependent protein (Dickeya dianthicola ME23)
MLSKLTGKGASGFTLPEVMLAMGMSSLIMLAVAQLLPLLRAQTQDSASLIRLEQLLGQTL
FGIEKDIRRAGFCAGRCQGPALTLEAGAMSQVSCLSVAYDVNRNGRWETGEQPEPEFFSY
RLRDGALEVQTGGPRCQGNRWEKLLDPSEVTIARFEVTKETPGAQPRYRVLLEGYWTARP
TRRRQVNSLVTGRNHAG