Protein Info for DZA65_RS05285 in Dickeya dianthicola ME23

Annotation: DNA mismatch repair endonuclease MutH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 TIGR02248: DNA mismatch repair endonuclease MutH" amino acids 11 to 226 (216 residues), 352.3 bits, see alignment E=3.6e-110 PF02976: MutH" amino acids 59 to 157 (99 residues), 126.2 bits, see alignment E=2.2e-41

Best Hits

Swiss-Prot: 87% identical to MUTH_PECCP: DNA mismatch repair protein MutH (mutH) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03573, DNA mismatch repair protein MutH (inferred from 97% identity to ddd:Dda3937_03389)

MetaCyc: 72% identical to DNA mismatch repair protein MutH (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA mismatch repair endonuclease MutH" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DSR7 at UniProt or InterPro

Protein Sequence (228 amino acids)

>DZA65_RS05285 DNA mismatch repair endonuclease MutH (Dickeya dianthicola ME23)
MQTPTPHQNAPDSEQALLLRAQALAGYSLAELARIAQLPLPADLKRDKGWIGVLLERFLG
ASAGSKPEQDFPDIGIELKTIPVDEQGRPLETTFVCVAPLTGNSGVTWESSHVRRKLTRV
LWIPVEGSRPIPLGERRIGAPLLWSPSPEEEQQLRRDWEELMDLIVLGKVESITARHGEV
LQLRPKAANSRALTDAIGEHGQPILTLPRGFYLKKTFTTPLLARHFLL