Protein Info for DZA65_RS05280 in Dickeya dianthicola ME23

Annotation: TerC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 84 to 100 (17 residues), see Phobius details amino acids 121 to 146 (26 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 212 to 229 (18 residues), see Phobius details PF03741: TerC" amino acids 16 to 202 (187 residues), 172.7 bits, see alignment E=3.2e-55

Best Hits

Swiss-Prot: 82% identical to YGDQ_ECO57: UPF0053 inner membrane protein YgdQ (ygdQ) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 98% identity to dze:Dd1591_3200)

Predicted SEED Role

"FIG003462: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D0K2 at UniProt or InterPro

Protein Sequence (238 amino acids)

>DZA65_RS05280 TerC family protein (Dickeya dianthicola ME23)
MFDWIADPNAWLALGTLTILEIVLGIDNIIFLSLVVAKLPKHQQNKARRIGLMGAMLMRL
GLLASIAWVIRLTNPLFSVFEQDVSARDLILFLGGLFLIWKSSKEIHETIEGGAQDHTSQ
VHSFFGAIVQIMLLDIIFSLDSVITAVGLSDHLFIMMAAVVIAVGVMMFSARPIGEFVDR
HPSVKMLALSFLILVGFTLILESVDIHVPKGYIYFAMFFSMSVEALNLMRGKKSVKKR