Protein Info for DZA65_RS05070 in Dickeya dianthicola ME23

Annotation: TIGR03756 family integrating conjugative element protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR03756: integrating conjugative element protein, PFL_4710 family" amino acids 26 to 326 (301 residues), 417.2 bits, see alignment E=1.9e-129 PF06834: TraU" amino acids 32 to 316 (285 residues), 193 bits, see alignment E=4.1e-61

Best Hits

KEGG orthology group: None (inferred from 74% identity to pwa:Pecwa_0679)

Predicted SEED Role

"FIG01047964: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XU31 at UniProt or InterPro

Protein Sequence (327 amino acids)

>DZA65_RS05070 TIGR03756 family integrating conjugative element protein (Dickeya dianthicola ME23)
MRMTLKTRRVLMATLLSVSWLTTASVNTAQIVASASSVSCISWRVKGICYWLLCTPFGCS
VKTSVRVEHFIPEAVVSAYGNSGDNPWTEMSLVSQSAASAEGGLIGSIAGVVVGGGNQEL
KAPEAGRKKNLRYLYSDAIGHPATSLIGGMVPGYSCRSAALPLNPYFLSSLDALFWRTSL
PESLYPEALIPGQRELGSQTGGNMWGNIYPRSGFVTQQDGYKAAALVAQRTADVITRNGQ
LHIYQALVGTPSPGYWPPEPVTENTGTTNHKWQALAPQLSMSCAIFPDNVGQASMPYSEQ
GNYAWALWQPYSCCQRRGQTLLYTTDI