Protein Info for DZA65_RS05005 in Dickeya dianthicola ME23

Annotation: integrative conjugative element protein, RAQPRD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01690: integrative conjugative element protein, RAQPRD family" amino acids 11 to 105 (95 residues), 102.4 bits, see alignment E=5.8e-34 PF09686: Plasmid_RAQPRD" amino acids 26 to 104 (79 residues), 83.1 bits, see alignment E=6.2e-28

Best Hits

KEGG orthology group: None (inferred from 61% identity to pwa:Pecwa_0652)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CVY9 at UniProt or InterPro

Protein Sequence (109 amino acids)

>DZA65_RS05005 integrative conjugative element protein, RAQPRD family (Dickeya dianthicola ME23)
MVVRSINPLKCVLSVVIFSFLFSASAQASEKDELALVMRQLEQVQAALNRAQVIASQNSG
DSARYYFDYSSATRDITAMKLGIERYLQPSRAQPAVPMNVTGQYSQESR