Protein Info for DZA65_RS04995 in Dickeya dianthicola ME23

Annotation: TIGR03747 family integrating conjugative element membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 157 to 183 (27 residues), see Phobius details amino acids 229 to 253 (25 residues), see Phobius details TIGR03747: integrating conjugative element membrane protein, PFL_4697 family" amino acids 21 to 257 (237 residues), 289.3 bits, see alignment E=1.2e-90 PF14348: DtrJ-like" amino acids 56 to 254 (199 residues), 214.4 bits, see alignment E=5.8e-68

Best Hits

KEGG orthology group: None (inferred from 52% identity to ecq:ECED1_3573)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D0F1 at UniProt or InterPro

Protein Sequence (257 amino acids)

>DZA65_RS04995 TIGR03747 family integrating conjugative element membrane protein (Dickeya dianthicola ME23)
MAQTQQQSQQQRPAAPPKQSGPIMFLLWDLPWKLVGIFLAAWLVSIIVEFACMTLIWPTA
GAEHSREVLHTESAYLSEGFTRSLLMSEPVITMNHVVNRVYQWGFVDTGFISWLNGSAAP
QTAAGHRRGELLEAISQTGRSLAMWVGEYLEAMMYVTLIYVIRVCILVLSIPLFVLVIIT
GVVDGLVRRDLRRYGAGYESSFLYHHAKRFIKPAFYGPTMLYLGWPTAVWPNLLILPAAV
LLGGVISVTMGAFKKYL