Protein Info for DZA65_RS04860 in Dickeya dianthicola ME23

Annotation: TIGR03761 family integrating conjugative element protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF08900: AcaB" amino acids 15 to 234 (220 residues), 222.2 bits, see alignment E=3.7e-70 TIGR03761: integrating conjugative element protein, PFL_4669 family" amino acids 17 to 235 (219 residues), 211 bits, see alignment E=7.7e-67

Best Hits

KEGG orthology group: None (inferred from 47% identity to ypi:YpsIP31758_3742)

Predicted SEED Role

"FIG141694: hypothetical protein in PFGI-1-like cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D373 at UniProt or InterPro

Protein Sequence (258 amino acids)

>DZA65_RS04860 TIGR03761 family integrating conjugative element protein (Dickeya dianthicola ME23)
MTEKTEKDELPSRARAGALVSELKIELHTNYAISLWEGRRAIFDDNNERVKFTIPSMPMF
IAAAGRINDASLADNPFADHVLYKLDLAIQSAFLKMNSYVSTLDRVLVAVPAGVHITDVV
SREPLDIQVFSRTPFGYRCVYLLVGFDQYAKKVLQAYHFGFISRNERDNYLSNGSRILRA
IYAIVQGYRAGPVTRQDVMDNSETYQKALSSYRLKELNPAILDGSRRASFCAPLNDEIRA
KMKAFQSQGGRDSVGAPS