Protein Info for DZA65_RS04715 in Dickeya dianthicola ME23

Annotation: type II toxin-antitoxin system toxin CcdB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 PF01845: CcdB" amino acids 2 to 100 (99 residues), 107.8 bits, see alignment E=1.5e-35

Best Hits

Swiss-Prot: 60% identical to CCDB_ECO57: Toxin CcdB (ccdB) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 90% identity to pct:PC1_0495)

Predicted SEED Role

"CcdB toxin protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CNM8 at UniProt or InterPro

Protein Sequence (101 amino acids)

>DZA65_RS04715 type II toxin-antitoxin system toxin CcdB (Dickeya dianthicola ME23)
MQFIVYQYKRASHYKMFVDVQSDIVETPKRRMVIPLIESHHLSEKVNKTLFPQIRIDGED
YRLMTTELSSVPVEVIGEELAELGDYADEIKDAINLMFWGI