Protein Info for DZA65_RS04660 in Dickeya dianthicola ME23

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF20434: BD-FAE" amino acids 78 to 287 (210 residues), 144.3 bits, see alignment E=1.2e-45 PF07859: Abhydrolase_3" amino acids 84 to 305 (222 residues), 63.4 bits, see alignment E=7.9e-21 PF00326: Peptidase_S9" amino acids 251 to 327 (77 residues), 43.3 bits, see alignment E=9.5e-15

Best Hits

KEGG orthology group: None (inferred from 72% identity to kpe:KPK_B0077)

Predicted SEED Role

"Alpha/beta hydrolase fold-3 domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVX6 at UniProt or InterPro

Protein Sequence (344 amino acids)

>DZA65_RS04660 alpha/beta hydrolase (Dickeya dianthicola ME23)
MKYSHVFLIGGFCMISAATGAIASEKNNLPGYTQGAEVVQIKTTQHQIDNIGDIVYEQVK
STRAVRQLHMSVLVPRSDDLKPTIIYYPGGGFMTADRDKFIEMRMALAGAGFVVAAAEYR
TIPDIFPAPVVDAKAAVRYLRQHATEYGIDPKRIGVLGDSSGGWLAQMLGMTNGDNSFDK
GDFLNQSSNVQAVATLYGISDLRDIGAGFPEAIQRVHKSPAVTEALLVNGPAFRDFPGAS
ITALPEKALNASPVGHLNGPKPPFLIMHGSKDTVVSPEQSAKLYNALKKAGDRADYVIIE
GADHGDNYWYQTAVINRVVGWFQQTLGLPEKTKNQSAVNPDANL