Protein Info for DZA65_RS04550 in Dickeya dianthicola ME23

Annotation: rhamnogalacturonate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF14686: fn3_3" amino acids 332 to 401 (70 residues), 44.6 bits, see alignment E=1e-15 PF14683: CBM-like" amino acids 415 to 571 (157 residues), 96.2 bits, see alignment E=2e-31

Best Hits

Swiss-Prot: 94% identical to RHIE_DICD3: Rhamnogalacturonate lyase (rhiE) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_01465)

Predicted SEED Role

"rhamnogalacturonate lyase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XU07 at UniProt or InterPro

Protein Sequence (576 amino acids)

>DZA65_RS04550 rhamnogalacturonate lyase (Dickeya dianthicola ME23)
MMKPLQAWRNPLLTLAFVLPLTATGAVKLTLDGMNSTLDNGLLKVRFGADGSAQEVWKDS
TNLISRLSGAARDPDKNRSFYLDYYSGGVNEFVPERLNVVKQTPDLVHLAYIDDQNGKLR
LEYHLIMTSGVSGLYSYVVAANTGPAPVTVSELRNVYRFDATRLNTLFNSIRRGTPPLYA
ELEQLPKVQDETWRLPDGSVYSKYDFAGYQRESRYWGVMGNGYGAWMVPASGEYYSGDAL
KQELLVHQDAIILNYLTGSHFGTPDMVMRPGFEKLYGPWLLYINQGNDRELVADVSRRAE
HERASWPYRWLDDARYPRQRATVSGSLRTEAPHATVVLNSSAEDFDIQTTGYLFSARTNR
DGRFSLDNVPPGEYRLSAYADGGTQIGLLAQQTVRVEGQKTRLGQIDAQRPAPLVWAIGQ
ADRRAEEFRFGDKPRQYHWQTEVPANLTFEIGKSREHKDWYYAQTQPGSWNILFNTRTPE
QPYTLNIAIAAASNSGMTTPASAPQLAVKLNGELLTTLKYDNDKAIYRGAMQSGRYHEAH
IPLPADALQPGGNRITLELLGGMVMYDAITLTETPQ