Protein Info for DZA65_RS04465 in Dickeya dianthicola ME23

Annotation: 4Fe-4S dicluster domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF12838: Fer4_7" amino acids 51 to 116 (66 residues), 30.4 bits, see alignment E=1.6e-10 PF13247: Fer4_11" amino acids 94 to 189 (96 residues), 88.8 bits, see alignment E=8e-29 PF13237: Fer4_10" amino acids 98 to 144 (47 residues), 26.4 bits, see alignment 1.9e-09 PF00037: Fer4" amino acids 127 to 147 (21 residues), 23.3 bits, see alignment (E = 1.5e-08)

Best Hits

Swiss-Prot: 48% identical to YDHX_ECOLI: Uncharacterized ferredoxin-like protein YdhX (ydhX) from Escherichia coli (strain K12)

KEGG orthology group: K04014, formate-dependent nitrite reductase, Fe-S protein (inferred from 96% identity to ddd:Dda3937_01447)

Predicted SEED Role

"NrfC protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CVP5 at UniProt or InterPro

Protein Sequence (232 amino acids)

>DZA65_RS04465 4Fe-4S dicluster domain-containing protein (Dickeya dianthicola ME23)
MENYTRRRFIAIMGSALAVSGSGLPAVAQETATLAGGPRPVKYGILHNELRCIGCKACMT
ACRKTNQVPEGVTRLNIIQTVDIPATDSTKPVKQFFRQSCQHCDNPPCVSVCPTGASFKD
ALTGIVDINDKRCVGCRYCIAACPYHVRFINPVTNTADKCNFCRETNLAAGKKPACVEIC
PTKALVFGDLNDPDSEISKMIKTNPIYRSKVYLGTGPNLYRIPGKYGESDHA