Protein Info for DZA65_RS04405 in Dickeya dianthicola ME23

Annotation: NADH:flavorubredoxin reductase NorW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 PF07992: Pyr_redox_2" amino acids 4 to 275 (272 residues), 197.5 bits, see alignment E=1.6e-61 PF13738: Pyr_redox_3" amino acids 66 to 270 (205 residues), 48.6 bits, see alignment E=3.1e-16 PF01593: Amino_oxidase" amino acids 120 to 239 (120 residues), 23.1 bits, see alignment E=2e-08 PF00070: Pyr_redox" amino acids 143 to 219 (77 residues), 58.7 bits, see alignment E=3e-19 PF18113: Rbx_binding" amino acids 315 to 383 (69 residues), 64 bits, see alignment E=4.2e-21

Best Hits

Swiss-Prot: 62% identical to NORW_PECAS: Nitric oxide reductase FlRd-NAD(+) reductase (norW) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K12265, nitric oxide reductase FlRd-NAD(+) reductase [EC: 1.18.1.-] (inferred from 89% identity to ddd:Dda3937_01435)

Predicted SEED Role

"Nitric oxide reductase FlRd-NAD(+) reductase (EC 1.18.1.-)" in subsystem Nitrosative stress (EC 1.18.1.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XTP3 at UniProt or InterPro

Protein Sequence (385 amino acids)

>DZA65_RS04405 NADH:flavorubredoxin reductase NorW (Dickeya dianthicola ME23)
MSDDIIVIGAGFAARQLIKNLRKQDSQRPIRLITADSGDEYNKPELSHVLSQHRHADDLT
RMSAAQFAEEQRIMLLAHTPVTGIDAGRRQVMCDTRCYDYHTLVLATGASAVIPPVPGHE
WMLTLNSQQEYRQAETRLTQATRILILGAGLIGSELAMDMAQAGKQVTLVDRASHLLSAL
LPVDISARLQAALLQQGVELMLNNELRQLEKTDAGLKVTLLSGRTLEVDEVISAVGLHAN
TSLAAAAGLAVNRGIVTDSRLRTSDPHIYALGDCAEINGKLLPFLQPIQLTASIAANSIS
GNTADNRVRDGNGSLALPAMLIKVKTPLFPLQLAGDTHNPELVWHIIADHGGIVAKGMAG
EQLRGFVVGGDRMKDAFALLRQLPS