Protein Info for DZA65_RS04330 in Dickeya dianthicola ME23

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF00072: Response_reg" amino acids 3 to 111 (109 residues), 88 bits, see alignment E=4.7e-29 PF00486: Trans_reg_C" amino acids 149 to 225 (77 residues), 75.2 bits, see alignment E=3.5e-25

Best Hits

Swiss-Prot: 43% identical to CPXR_ECOLI: Transcriptional regulatory protein CpxR (cpxR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_01421)

MetaCyc: 43% identical to DNA-binding transcriptional dual regulator CpxR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Transcriptional regulatory protein cpxR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XTW9 at UniProt or InterPro

Protein Sequence (226 amino acids)

>DZA65_RS04330 response regulator transcription factor (Dickeya dianthicola ME23)
MKILLVDDDAELGHMLCEYLTAEGFSTSQVMTGKEGVDGAMSSQYTAMILDIMLPDMSGI
DVLRQVRRNRSIPIIMLTAKGDNIDRVIGLEMGADDYVPKPCYPRELVARLRAVLRRYED
KAERSEDTGTVNYGELAVCPSTRGSEWRGKAFDLTASEFNLLELLIRSSERVVTKDELSE
KCLGRRREAYDRSVDVHISNIRQKLAALDGCNLTIETVRSVGYRIR