Protein Info for DZA65_RS04230 in Dickeya dianthicola ME23
Annotation: outer membrane protein assembly factor BamE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 78% identical to BAME_SALTY: Outer membrane protein assembly factor BamE (bamE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K06186, small protein A (inferred from 96% identity to ddc:Dd586_0772)Predicted SEED Role
"Outer membrane lipoprotein SmpA, a component of the essential YaeT outer-membrane protein assembly complex"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4D3G6 at UniProt or InterPro
Protein Sequence (114 amino acids)
>DZA65_RS04230 outer membrane protein assembly factor BamE (Dickeya dianthicola ME23) MRCKTLTVVAAVVVVMLTAGCSTLGRVVYRPDINQGNYLAPADVAKIHNGMTKQQVIYTL GTPMMQDPFGSDTWYYVFRQQPGHEAVKQQTLTLTFNSQGVLANVDNKPTLQTQ