Protein Info for DZA65_RS04155 in Dickeya dianthicola ME23

Annotation: phage tail tape measure protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 transmembrane" amino acids 332 to 353 (22 residues), see Phobius details amino acids 373 to 405 (33 residues), see Phobius details amino acids 411 to 430 (20 residues), see Phobius details amino acids 434 to 438 (5 residues), see Phobius details amino acids 441 to 460 (20 residues), see Phobius details amino acids 464 to 486 (23 residues), see Phobius details TIGR01760: phage tail tape measure protein, TP901 family, core region" amino acids 53 to 387 (335 residues), 52.1 bits, see alignment E=2.6e-18 PF10145: PhageMin_Tail" amino acids 85 to 284 (200 residues), 70.3 bits, see alignment E=1.1e-23

Best Hits

KEGG orthology group: None (inferred from 94% identity to ddc:Dd586_0757)

Predicted SEED Role

"COG5283: Phage-related tail protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CDK0 at UniProt or InterPro

Protein Sequence (654 amino acids)

>DZA65_RS04155 phage tail tape measure protein (Dickeya dianthicola ME23)
MKQLDFTLSLIDKLTRPVKQAQAAVTGFAKSSRDAFSKIAVGGAGLIGTAMSIQGALGPA
VEMHGAMVEASARGVDDSALQKINANALKFSTQYGRSALEYVQSTARINAAVGTLTKEDL
PGVVRASNVMAAALKATADESSEFMGQMFANFRSDAESMGNVQFAEQLAGKAAYMRNAFG
VELGAIKDLMEGARGVGTNYGIGMDEQLAVMGELQRTLGTEASSAYEGFLSGAVKGAQKL
GLSFEDSNGKLLTMPAMLEKLRGKYGASIEGNLKAQSDLDDAFGDSAAVIKQLYGNVGVL
QRHITELGSNDGMTRATEMAQKMTSPWERLTAIWYAIRAAMGATLLPVLYPLINKMADGG
QVLVRWLNLFPNITRVIGYCVLAVLSLAGAGAIANIVMGVSVFMLGGLKGLWKGLTAIMK
IHVGVIWLYNKAVLAWAATMRILRGVLLAVRMASLLTGMAFNIALWPVLLIIGAVALLVA
GCSLLIRHWDGIKNAITQTDMWKTVAEKVQWVAEIFSQTWKAIIDGWNRVVNAMGSFSLT
ETMGKMADGVGEIFSGLWDGILASFNSSYRWIIGKLNAIPGINIAMPESVPRPGGEGLLT
GGKIKGIDSGGLQRDISNSNAKNYTDNSRKVENLTIYANKGFTPEQLTEWEALR