Protein Info for DZA65_RS04090 in Dickeya dianthicola ME23

Annotation: phage major capsid protein, P2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR01551: phage major capsid protein, P2 family" amino acids 8 to 318 (311 residues), 343.7 bits, see alignment E=5e-107 PF05125: Phage_cap_P2" amino acids 11 to 324 (314 residues), 365.7 bits, see alignment E=1.1e-113

Best Hits

KEGG orthology group: None (inferred from 98% identity to ddc:Dd586_0744)

Predicted SEED Role

"Phage major capsid protein" in subsystem Phage capsid proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D6N1 at UniProt or InterPro

Protein Sequence (342 amino acids)

>DZA65_RS04090 phage major capsid protein, P2 family (Dickeya dianthicola ME23)
MFLNQRAREYLSAYSVGLAQEYGVADTARYFALTDPKETQLRAALLERVDFLSMINVLDV
DQLSGQVVSVGSSALHTGRKEGGRFIRQVGVEGNDYKLVETDSCAALPWDLLSVWANAGG
EDEFFQLVQAFSNEAFALDMLRIGFNGNSVAKSTDPDENPNGEDVNIGWHQRMKDFKDGQ
QIITDRVVLDENGDYKSLDAMASDLINAKIPQQYRNDPRLVVMVGADLVAAEQYRLFQKA
DRPTEKIAAQMLDSTIAGRPAIVPPFMPGKRMTVTTLSNLHIYTQRNTRQRKAEFVEDRK
QFENKYLRNEGYAVEYPELYASFDESAVTIGTVAEPAEKEPA