Protein Info for DZA65_RS04075 in Dickeya dianthicola ME23

Annotation: phage portal protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR01540: phage portal protein, PBSX family" amino acids 52 to 324 (273 residues), 223.1 bits, see alignment E=2.7e-70 PF04860: Phage_portal" amino acids 97 to 332 (236 residues), 61.9 bits, see alignment E=3e-21

Best Hits

Swiss-Prot: 52% identical to PORTL_BPHC1: Probable portal protein from Haemophilus phage HP1 (strain HP1c1)

KEGG orthology group: None (inferred from 99% identity to ddc:Dd586_0741)

Predicted SEED Role

"Membrane proteins related to metalloendopeptidases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CM23 at UniProt or InterPro

Protein Sequence (342 amino acids)

>DZA65_RS04075 phage portal protein (Dickeya dianthicola ME23)
MKRTSHRRQKAQNAPRKKMSIITFGKPEPVLTTGTDYRDVWYDNEFNHYTLPIDRLALAQ
LVNLNGQHGGILYARRNMVASDYQGGGLSHDDMLAAAFDYLTFGDIAILKVRNGWGEVIA
LTPLPALYTRIRKTGEFVVLQKGEPLVYPPEDVIFIKMYDPQQQIYGLPDYIGGIHSALL
NSEAVIFRRRYYHNGAHTGGILYTSDPNMTDEIEEEIERQLASSKGIGNFSTILVNIPNG
DKEGVQFIQMGDISAKDEFANVKNISAQDVLNAHRFPAGLCGIIPQNAAGLGDPEKARNT
YRKDEVIPIQRRFMASINKDPEIPQNLHLIFDVGDDTTIQGA