Protein Info for DZA65_RS04055 in Dickeya dianthicola ME23

Annotation: replication endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 684 PF05840: Phage_GPA" amino acids 136 to 457 (322 residues), 378.2 bits, see alignment E=3e-117 PF23343: REP_ORF2-G2P" amino acids 356 to 453 (98 residues), 27.8 bits, see alignment E=2.5e-10

Best Hits

KEGG orthology group: None (inferred from 96% identity to dda:Dd703_3837)

Predicted SEED Role

"Replication gene A protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CXF3 at UniProt or InterPro

Protein Sequence (684 amino acids)

>DZA65_RS04055 replication endonuclease (Dickeya dianthicola ME23)
MTDLQIPEHNGAYHAVREWQREQFSPGEPAGLSYVERSLWHLNPLDHQWRQQYLAGMPDY
LAKYFGLRYEKLFKSDEHKGRRRANTFLLRTLGKSVLPRLRTVTERYQTQQHAAGDLPFP
FYDDLEKLPVYDRDNIRALSQQLADFMAASLRDYTENRIRNTGKLTDRHITLLSFRHLGL
LTLQAGTQPPYWAQFTKGRHPLSTEKAESGLLRMMSPEWWRARLKRRRDIQREHMAIAVG
QVQKAASPYVSRSTLDEWKEQKRRNREFFKAFELEDDEGNRVSLDDKVNASNANPAIRRC
ELMVRMRGFEDLAQEMGCAGEFYTITAPSRYHAVHSGGGFVEQWSGASPRDTQKYLCGVW
ARIRAELSREEISVFGFRVVEPHHDGTPHWHLLLFMRPEHIEQVRDIMAYHARREDANEL
NSEKAQKARFHYEPIDPEKGSATGYIAKYISKNIDGYALDGEADEETGENLRDMAKAVSA
WASRWRIRQFQQIGGAPVTVYRELRRLGDKQLDNAAMDAVLAAADVGDWAAYTQAQGGPL
VSRDALVVRLSYEVTERANQYAEDVQKVQGVYSPLLGAPSAIITRTVQWKIVPKQATASA
GAGVSGGSAAAWSSVNNCTPGLRRRLSELLRLRGFPPDPGLVDVLMRGGHLAMSEGRALK
MVSGRLEEVRQTGDCELWLGWNWG