Protein Info for DZA65_RS04045 in Dickeya dianthicola ME23

Annotation: Dam family site-specific DNA-(adenine-N6)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR00571: DNA adenine methylase" amino acids 5 to 266 (262 residues), 276.9 bits, see alignment E=1e-86 PF02086: MethyltransfD12" amino acids 10 to 246 (237 residues), 214.3 bits, see alignment E=1.3e-67

Best Hits

Swiss-Prot: 60% identical to DMA7_ECOLX: Retron EC67 DNA adenine methylase from Escherichia coli

KEGG orthology group: K06223, DNA adenine methylase [EC: 2.1.1.72] (inferred from 90% identity to dda:Dd703_3839)

MetaCyc: 45% identical to DNA adenine methyltransferase (Escherichia coli K-12 substr. MG1655)
Site-specific DNA-methyltransferase (adenine-specific). [EC: 2.1.1.72]

Predicted SEED Role

"Methyl-directed repair DNA adenine methylase (EC 2.1.1.72)" in subsystem DNA repair, bacterial (EC 2.1.1.72)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CDM2 at UniProt or InterPro

Protein Sequence (318 amino acids)

>DZA65_RS04045 Dam family site-specific DNA-(adenine-N6)-methyltransferase (Dickeya dianthicola ME23)
MSTIATPLKWVGSKARVMDILREHLPAGDRLVEPFAGSCAVMMNTDYPEYLIADINPDLI
NLYQVIKEDLKDFIDTAEGLFRTANTAESYYRFRQVFNRSKENRITSAALFLYLNRHGYR
GVCRYNRAGGFNVPYGNYASPYFPLAEIQAFAEKARRAKFICAAFGETLQLIRTGDVVYC
DPPYIPQTPTASFTSYHTDGFTRNDQYDLCSALLRLAERGIPVIASNSDTHHAHSIYHRF
DICRFTAPRSVGVAAGESKQAGEIIAKRLPVPVASNIAKVCDGCGYEGGGHCPDCGPVMG
DATYQEMVASGALDADPF