Protein Info for DZA65_RS03900 in Dickeya dianthicola ME23
Annotation: 5-deoxy-glucuronate isomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 55% identical to IOLB_GEOTN: 5-deoxy-glucuronate isomerase (iolB) from Geobacillus thermodenitrificans (strain NG80-2)
KEGG orthology group: K03337, 5-deoxy-glucuronate isomerase [EC: 5.3.1.-] (inferred from 96% identity to ddd:Dda3937_01210)MetaCyc: 48% identical to 5-deoxy-D-glucuronate isomerase (Bacillus subtilis subtilis 168)
RXN-14150 [EC: 5.3.1.30]
Predicted SEED Role
"5-deoxy-glucuronate isomerase (EC 5.3.1.-)" in subsystem Inositol catabolism (EC 5.3.1.-)
MetaCyc Pathways
- myo-inositol degradation I (6/7 steps found)
- myo-, chiro- and scyllo-inositol degradation (6/10 steps found)
KEGG Metabolic Maps
- Biosynthesis of ansamycins
- Galactose metabolism
- Inositol phosphate metabolism
- Pentose and glucuronate interconversions
Isozymes
Compare fitness of predicted isozymes for: 5.3.1.-
Use Curated BLAST to search for 5.3.1.- or 5.3.1.30
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4CIF2 at UniProt or InterPro
Protein Sequence (275 amino acids)
>DZA65_RS03900 5-deoxy-glucuronate isomerase (Dickeya dianthicola ME23) MSELLSRYHAPDEQGRIQQITPARAGWRHVGFEVYQLSTGATLALPAVAEERCLVLVGGR ATVVTPLARFEHIGDRMNPFERKKPWAVYVSPGETVTVIADTPLELAVCAAPGWSNHPTR LIAPPDIGAQARGAGRNRRFVHNILPEDKVADSLLVVEVYTDEGCTSSYPSHKHDVDNPP QETYLEETYYHRLNPPQGFCLQRVYTEDRSLDECMAAYDRDVVMVPRGYHPVATLAGYDS YYLNVMAGPVRQWRFSWEQDHQWVNSAEYAAKHSG