Protein Info for DZA65_RS03900 in Dickeya dianthicola ME23

Annotation: 5-deoxy-glucuronate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF04962: KduI" amino acids 8 to 264 (257 residues), 348 bits, see alignment E=1.7e-108 TIGR04378: 5-deoxy-glucuronate isomerase" amino acids 19 to 264 (246 residues), 308.2 bits, see alignment E=2.1e-96

Best Hits

Swiss-Prot: 55% identical to IOLB_GEOTN: 5-deoxy-glucuronate isomerase (iolB) from Geobacillus thermodenitrificans (strain NG80-2)

KEGG orthology group: K03337, 5-deoxy-glucuronate isomerase [EC: 5.3.1.-] (inferred from 96% identity to ddd:Dda3937_01210)

MetaCyc: 48% identical to 5-deoxy-D-glucuronate isomerase (Bacillus subtilis subtilis 168)
RXN-14150 [EC: 5.3.1.30]

Predicted SEED Role

"5-deoxy-glucuronate isomerase (EC 5.3.1.-)" in subsystem Inositol catabolism (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.- or 5.3.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CIF2 at UniProt or InterPro

Protein Sequence (275 amino acids)

>DZA65_RS03900 5-deoxy-glucuronate isomerase (Dickeya dianthicola ME23)
MSELLSRYHAPDEQGRIQQITPARAGWRHVGFEVYQLSTGATLALPAVAEERCLVLVGGR
ATVVTPLARFEHIGDRMNPFERKKPWAVYVSPGETVTVIADTPLELAVCAAPGWSNHPTR
LIAPPDIGAQARGAGRNRRFVHNILPEDKVADSLLVVEVYTDEGCTSSYPSHKHDVDNPP
QETYLEETYYHRLNPPQGFCLQRVYTEDRSLDECMAAYDRDVVMVPRGYHPVATLAGYDS
YYLNVMAGPVRQWRFSWEQDHQWVNSAEYAAKHSG