Protein Info for DZA65_RS03740 in Dickeya dianthicola ME23
Annotation: ABC transporter ATP-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 42% identical to AMIF_STRPN: Oligopeptide transport ATP-binding protein AmiF (amiF) from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 99% identity to ddd:Dda3937_01164)Predicted SEED Role
"Dipeptide transport ATP-binding protein DppF (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A385XTE6 at UniProt or InterPro
Protein Sequence (257 amino acids)
>DZA65_RS03740 ABC transporter ATP-binding protein (Dickeya dianthicola ME23) MIEVRNLNLTFGEGSAQNQVLYDVNLTVNDGEIFGLVGESGSGKTTVLKCLAGLFNHWQG QLWIDDQPLAHRIEQARCRRVQMVFQDPYGSLHPRHTVETILEEPLLIHRFADRDDRIDT LLSKVGLGPQFRRRYPHQLSGGQRQRVAIARALILEPRVLLLDEPTSALDVSVQAEILNL LAELQQQEKLTYLMVTHDLGVIAHLCHNVAVMQYGRILETLATGDLARDTPKSAYTTMLV DASRQYSRDLAVQSERM