Protein Info for DZA65_RS03690 in Dickeya dianthicola ME23

Annotation: DUF485 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 transmembrane" amino acids 25 to 50 (26 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details PF04341: DUF485" amino acids 11 to 98 (88 residues), 109.2 bits, see alignment E=4e-36

Best Hits

Swiss-Prot: 72% identical to YJCH_ECOLI: Inner membrane protein YjcH (yjcH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to dda:Dd703_3261)

Predicted SEED Role

"Putative membrane protein, clustering with ActP" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CFY8 at UniProt or InterPro

Protein Sequence (103 amino acids)

>DZA65_RS03690 DUF485 domain-containing protein (Dickeya dianthicola ME23)
MNDLIYQRIEDNPLFKELVHKRQRFAALLSLIMLVLYVGFILLIAFAPGWLGTPIAPGAG
TTRGIPLGIGLIVISFVLTGIYVYRANGEFDRLTKALLNEVQK