Protein Info for DZA65_RS03655 in Dickeya dianthicola ME23

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 31 to 54 (24 residues), see Phobius details amino acids 90 to 115 (26 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 155 to 179 (25 residues), see Phobius details amino acids 201 to 225 (25 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 110 to 280 (171 residues), 61.9 bits, see alignment E=3.4e-21

Best Hits

KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 98% identity to ddc:Dd586_0676)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 2" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CPG2 at UniProt or InterPro

Protein Sequence (295 amino acids)

>DZA65_RS03655 carbohydrate ABC transporter permease (Dickeya dianthicola ME23)
MSVEISPAVTCSTRAPLPAWLRWRQSRRATLSLLMICAALLWISPFIWMLSSAFSATTFG
VGMASLLPRWPLTLSNFRDAWQSADWISLYANTIFFTFGTFFVQLLTITTAGYVFACHEF
RGKQTLFLLFLVQLMIMPVVMMVPNMMTLKAFGLLNTLTGVMMPYFTSAFGVFLMRQAFL
AIPKEIEEAALMEGCRWWQVLFRVLLPMSWPSILAFATVSITYHWNEYLWPLMMLNDPDK
QVLTVGLVSFAMGAESGGQWGMISAGTLMVCLPLMLAFIVFQKQFLRSFGFSGIK