Protein Info for DZA65_RS03645 in Dickeya dianthicola ME23

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF03215: Rad17" amino acids 16 to 81 (66 residues), 24.2 bits, see alignment E=7.2e-09 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 125.9 bits, see alignment E=4.3e-40 PF17912: OB_MalK" amino acids 235 to 279 (45 residues), 33.7 bits, see alignment 1.4e-11 PF08402: TOBE_2" amino acids 273 to 346 (74 residues), 52.1 bits, see alignment E=1.5e-17

Best Hits

Swiss-Prot: 50% identical to MALK_THELN: Trehalose/maltose import ATP-binding protein MalK (malK) from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_02270)

Predicted SEED Role

"Probable sugar ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XTH4 at UniProt or InterPro

Protein Sequence (361 amino acids)

>DZA65_RS03645 ABC transporter ATP-binding protein (Dickeya dianthicola ME23)
MAMLRLHNVSKRFDDKPALRSLSLEIADGEFLVLVGPSGCGKSTLLRLLAGLETVSDGEM
WLDGDDITALPPRERNFAMIFQNYALFPHLTVKENITFGMQIRHEPKASWQPRLEKVAQL
LQLDELLDRKPGKLSGGQRQRVAMARAIVRNPKLFLMDEPLSNLDARLRTEVRDGIMALH
RQLKTSTVYVTHDQTEAMSMADRIVVMNHGEVQQVGTPEQLYAFPTNRFVASFIGSPAMN
IITLPCADGAVQVGEQALPLPPHAGQLRQVFFGIRPEHLTDAPETEQHTLRLPGTVMQRE
LMGADYLLHISTPIGELRYSRKNRGDAPQVGDTVSLGFSPFDVHLFHADTQQNVYQENTH
A