Protein Info for DZA65_RS03600 in Dickeya dianthicola ME23

Annotation: efflux transporter outer membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 13 to 458 (446 residues), 351.5 bits, see alignment E=3.7e-109 PF02321: OEP" amino acids 67 to 249 (183 residues), 152.5 bits, see alignment E=5.6e-49 amino acids 273 to 457 (185 residues), 160 bits, see alignment E=2.8e-51

Best Hits

Swiss-Prot: 92% identical to SILC_SALTM: Probable outer membrane lipoprotein SilC (silC) from Salmonella typhimurium

KEGG orthology group: K07796, Cu(I)/Ag(I) efflux system outer membrane protein CusC (inferred from 92% identity to enc:ECL_A033)

MetaCyc: 70% identical to copper/silver export system outer membrane channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-90; TRANS-RXN0-280

Predicted SEED Role

"Cation efflux system protein CusC precursor" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CMF3 at UniProt or InterPro

Protein Sequence (461 amino acids)

>DZA65_RS03600 efflux transporter outer membrane subunit (Dickeya dianthicola ME23)
MFKLKLLSISTIFILAGCVSLASEYQRPAAPVPQQFSLSRNSLTPAVNGYQDSGWRNFFV
DPQVTRLITEALNNNRDLRMAALKVEEARAQFNVTNADRYPQLNASSDITYSGGLKSDKP
TTRQYEAGLDLSYELDFFGKLRNMSESDRQNYFASEEARRAVHILLVSNVSQSYFSQQLA
YEQRRIARETLKNYEQSYAFVEQQLVTGSTNVLALEQARGQIESTRAEIAKRDGDLAQAN
NALQLVLGTYRALPSEKGMKDNDIKPVKLPPNLSSQILLQRPDIMEAEYQLKAADANIGA
ARAAFFPSISLTSGLSANSTELSSLFTSAGGMWNFIPKIEIPIFNAGRNKANLKLAEIRQ
QQSVVNYEQKIQSAFKNVADTLALRDSISQQLASQQRYLDSLQITLQRARGLYSSGAVSY
IEVLDAERSLFTTQQAILDLIYSRQVNEINLFTALGGGWVE